PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.8G244100.2.p
Common NameSETIT_026803mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 173aa    MW: 19477.1 Da    PI: 7.3411
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.8G244100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-16243548
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +++E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  Seita.8G244100.2.p  2 SPQEERLIIELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 43
                        89****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.1E-11145IPR001005SANT/Myb domain
PROSITE profilePS5129424.881147IPR017930Myb domain
CDDcd001671.17E-12143No hitNo description
SuperFamilySSF466897.49E-13248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-20244IPR009057Homeodomain-like
PfamPF002493.5E-15242IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MSPQEERLII ELHARWGNRW SRIARRLPGR TDNEIKNYWR THMRKKAQER KMSISPSSSS  60
SSLTYQSCLL DTSPIIGMSS GDTHNGSSCV TSALDSTQSS MDAYPMDQIW REIEAPQAPA  120
LLGIAEGKEK TCSSIPCPLP SPAMWDYKCP EIFWKMEDEE IRMLAPSFGY GK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6524631e-173EU652463.1 Saccharum officinarum MYB protein (MYBAS1) mRNA, complete cds, alternatively spliced.
GenBankEU6702361e-173EU670236.1 Saccharum officinarum MYB transcription factor MYBAS1 (MYBAS1) mRNA, complete cds, alternatively spliced.
GenBankHM1367801e-173HM136780.1 Saccharum hybrid cultivar Co 740 MYB transcription factor variant 1 (MYBAS1) mRNA, complete cds, alternatively spliced.
GenBankHM1367811e-173HM136781.1 Saccharum hybrid cultivar Co 740 MYB transcription factor variant 2 (MYBAS1) mRNA, complete cds.
GenBankHM1367821e-173HM136782.1 Saccharum hybrid cultivar Co 740 MYB transcription factor variant 3 (MYBAS1) mRNA, complete cds, alternatively spliced.
GenBankKM3874101e-173KM387410.1 Saccharum officinarum cultivar Badila R2R3-MYB transcription factor variant 1 mRNA, complete cds, alternatively spliced.
GenBankKM3874111e-173KM387411.1 Saccharum officinarum cultivar Badila R2R3-MYB transcription factor variant 2 mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980031.11e-125PREDICTED: myb-related protein MYBAS1-like
SwissprotQ53NK63e-88MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLK3ZK151e-126K3ZK15_SETIT; Uncharacterized protein
STRINGSi026803m1e-124(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.15e-34myb domain protein 59